Lineage for d3qzla_ (3qzl A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766795Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2766796Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 2766819Protein automated matches [191246] (3 species)
    not a true protein
  7. 2766820Species Staphylococcus aureus [TaxId:158879] [189734] (5 PDB entries)
  8. 2766823Domain d3qzla_: 3qzl A: [184724]
    automated match to d2o1aa1
    complexed with gol, hem

Details for d3qzla_

PDB Entry: 3qzl (more details), 1.3 Å

PDB Description: staphylococcus aureus isda neat domain k75a variant in complex with heme
PDB Compounds: (A:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d3qzla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qzla_ b.1.28.1 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]}
atsqpinfqvqadgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann
qelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaiptl
a

SCOPe Domain Coordinates for d3qzla_:

Click to download the PDB-style file with coordinates for d3qzla_.
(The format of our PDB-style files is described here.)

Timeline for d3qzla_: