Lineage for d3qzba1 (3qzb A:1-131)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374770Superfamily b.1.13: Superoxide reductase-like [49367] (2 families) (S)
  5. 2374838Family b.1.13.0: automated matches [191383] (1 protein)
    not a true family
  6. 2374839Protein automated matches [190481] (2 species)
    not a true protein
  7. 2374861Species Thermotoga maritima [TaxId:2336] [187409] (2 PDB entries)
  8. 2374862Domain d3qzba1: 3qzb A:1-131 [184721]
    Other proteins in same PDB: d3qzba2
    automated match to d1do6a_
    complexed with fe

Details for d3qzba1

PDB Entry: 3qzb (more details), 1.1 Å

PDB Description: crystal structure of a putative superoxide reductase (tm0658) from thermotoga maritima at 1.10 a resolution
PDB Compounds: (A:) Putative superoxide reductase

SCOPe Domain Sequences for d3qzba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qzba1 b.1.13.0 (A:1-131) automated matches {Thermotoga maritima [TaxId: 2336]}
mklsdfiktedfkkekhvpvieapekvkkdekvqivvtvgkeiphpnttehhirwikvff
qpdgdpyvyevgryefnahgesvqgpnigavyteptvttvvklnrsgtiialsycnihgl
wessqkitvee

SCOPe Domain Coordinates for d3qzba1:

Click to download the PDB-style file with coordinates for d3qzba1.
(The format of our PDB-style files is described here.)

Timeline for d3qzba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qzba2