SCOPe 2.07: Domain d3qzba1: 3qzb A:1-131

Lineage for d3qzba1 (3qzb A:1-131)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (2 families)

5. Family b.1.13.0: automated matches [191383] (1 protein)
   not a true family

6. Protein automated matches [190481] (2 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [187409] (2 PDB entries)

8. Domain d3qzba1: 3qzb A:1-131 [184721]
   Other proteins in same PDB: d3qzba2
   automated match to d1do6a_
   complexed with fe

Details for d3qzba1

PDB Entry: 3qzb, 1.1 Å

PDB Description: crystal structure of a putative superoxide reductase (tm0658) from thermotoga maritima at 1.10 a resolution

PDB Compounds: (A:) Putative superoxide reductase

SCOPe Domain Sequences for d3qzba1:

Sequence; same for both SEQRES and ATOM records:

>d3qzba1 b.1.13.0 (A:1-131) automated matches {Thermotoga maritima [TaxId: 2336]}
mklsdfiktedfkkekhvpvieapekvkkdekvqivvtvgkeiphpnttehhirwikvff
qpdgdpyvyevgryefnahgesvqgpnigavyteptvttvvklnrsgtiialsycnihgl
wessqkitvee

Timeline for d3qzba1:

• d3qzba1 first appeared in SCOPe 2.01, called d3qzba_
  
• d3qzba1 appears in SCOPe 2.06
  
• d3qzba1 appears in the current release, SCOPe 2.08