Lineage for d3qz9h_ (3qz9 H:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783857Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2783858Protein automated matches [191237] (8 species)
    not a true protein
  7. 2783916Species Pseudomonas putida [TaxId:303] [189678] (5 PDB entries)
  8. 2783932Domain d3qz9h_: 3qz9 H: [184720]
    Other proteins in same PDB: d3qz9a_, d3qz9c_, d3qz9e_, d3qz9g_
    automated match to d1ireb_
    complexed with 3co, gol

Details for d3qz9h_

PDB Entry: 3qz9 (more details), 2.4 Å

PDB Description: crystal structure of co-type nitrile hydratase beta-y215f from pseudomonas putida.
PDB Compounds: (H:) Co-type Nitrile Hydratase beta subunit

SCOPe Domain Sequences for d3qz9h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qz9h_ b.34.4.0 (H:) automated matches {Pseudomonas putida [TaxId: 303]}
mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp
ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas
aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge
hpqhvytvsftsvelwgqdasspkdtirvdlwddflepa

SCOPe Domain Coordinates for d3qz9h_:

Click to download the PDB-style file with coordinates for d3qz9h_.
(The format of our PDB-style files is described here.)

Timeline for d3qz9h_: