![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
![]() | Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
![]() | Protein automated matches [191237] (4 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [189678] (5 PDB entries) |
![]() | Domain d3qz9d_: 3qz9 D: [184718] Other proteins in same PDB: d3qz9a_, d3qz9c_, d3qz9e_, d3qz9g_ automated match to d1ireb_ complexed with 3co, gol |
PDB Entry: 3qz9 (more details), 2.4 Å
SCOPe Domain Sequences for d3qz9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qz9d_ b.34.4.0 (D:) automated matches {Pseudomonas putida [TaxId: 303]} mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge hpqhvytvsftsvelwgqdasspkdtirvdlwddflepa
Timeline for d3qz9d_: