| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
| Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
| Protein automated matches [191237] (8 species) not a true protein |
| Species Pseudomonas putida [TaxId:303] [189678] (5 PDB entries) |
| Domain d3qz5f_: 3qz5 F: [184714] Other proteins in same PDB: d3qz5a_, d3qz5c_, d3qz5e_, d3qz5g_ automated match to d1ugpb_ complexed with 3co, gol |
PDB Entry: 3qz5 (more details), 2.5 Å
SCOPe Domain Sequences for d3qz5f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qz5f_ b.34.4.0 (F:) automated matches {Pseudomonas putida [TaxId: 303]}
mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp
ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas
aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge
hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa
Timeline for d3qz5f_: