Lineage for d3qz3c_ (3qz3 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2703293Species Vibrio cholerae [TaxId:243277] [189679] (1 PDB entry)
  8. 2703296Domain d3qz3c_: 3qz3 C: [184711]
    automated match to d1euma_
    complexed with edo

Details for d3qz3c_

PDB Entry: 3qz3 (more details), 2.1 Å

PDB Description: The crystal structure of ferritin from Vibrio cholerae O1 biovar El Tor str. N16961
PDB Compounds: (C:) Ferritin

SCOPe Domain Sequences for d3qz3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qz3c_ a.25.1.1 (C:) automated matches {Vibrio cholerae [TaxId: 243277]}
mlsqamvehlneqinleffssnlylqmsawcedkgfdgaaeflrahaveemqhmqrlfty
vsetgalpilgaiaaprhdfaslgevfretyqheqkitqqinklahvaftsqdystfnfl
qwyvaeqheeeklfkgildklelvgedgkalffidkdlaalakk

SCOPe Domain Coordinates for d3qz3c_:

Click to download the PDB-style file with coordinates for d3qz3c_.
(The format of our PDB-style files is described here.)

Timeline for d3qz3c_: