Lineage for d3qyhh_ (3qyh H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 946680Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 946759Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 946760Protein automated matches [191237] (1 species)
    not a true protein
  7. 946761Species Pseudomonas putida [TaxId:303] [189678] (5 PDB entries)
  8. 946765Domain d3qyhh_: 3qyh H: [184702]
    automated match to d1ugpb_
    complexed with 3co

Details for d3qyhh_

PDB Entry: 3qyh (more details), 2 Å

PDB Description: crystal structure of co-type nitrile hydratase beta-h71l from pseudomonas putida.
PDB Compounds: (H:) Co-type Nitrile Hydratase beta subunit

SCOPe Domain Sequences for d3qyhh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qyhh_ b.34.4.0 (H:) automated matches {Pseudomonas putida [TaxId: 303]}
mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp
ahylegtyyelwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas
aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge
hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa

SCOPe Domain Coordinates for d3qyhh_:

Click to download the PDB-style file with coordinates for d3qyhh_.
(The format of our PDB-style files is described here.)

Timeline for d3qyhh_: