Lineage for d3qyhd_ (3qyh D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536816Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 1536899Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 1536900Protein automated matches [191237] (2 species)
    not a true protein
  7. 1536910Species Pseudomonas putida [TaxId:303] [189678] (5 PDB entries)
  8. 1536912Domain d3qyhd_: 3qyh D: [184700]
    Other proteins in same PDB: d3qyha_, d3qyhc_, d3qyhe_, d3qyhg_
    automated match to d1ugpb_
    complexed with 3co

Details for d3qyhd_

PDB Entry: 3qyh (more details), 2 Å

PDB Description: crystal structure of co-type nitrile hydratase beta-h71l from pseudomonas putida.
PDB Compounds: (D:) Co-type Nitrile Hydratase beta subunit

SCOPe Domain Sequences for d3qyhd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qyhd_ b.34.4.0 (D:) automated matches {Pseudomonas putida [TaxId: 303]}
mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp
ahylegtyyelwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas
aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge
hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa

SCOPe Domain Coordinates for d3qyhd_:

Click to download the PDB-style file with coordinates for d3qyhd_.
(The format of our PDB-style files is described here.)

Timeline for d3qyhd_: