![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) ![]() |
![]() | Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
![]() | Protein automated matches [191237] (4 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [189678] (5 PDB entries) |
![]() | Domain d3qyhb_: 3qyh B: [184699] Other proteins in same PDB: d3qyha_, d3qyhc_, d3qyhe_, d3qyhg_ automated match to d1ugpb_ complexed with 3co |
PDB Entry: 3qyh (more details), 2 Å
SCOPe Domain Sequences for d3qyhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qyhb_ b.34.4.0 (B:) automated matches {Pseudomonas putida [TaxId: 303]} mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp ahylegtyyelwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa
Timeline for d3qyhb_: