Lineage for d3qyda_ (3qyd A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 951553Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 951953Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 951954Family b.42.4.1: Kunitz (STI) inhibitors [50387] (8 proteins)
  6. 951990Protein automated matches [190504] (2 species)
    not a true protein
  7. 951993Species Winged bean (Psophocarpus tetragonolobus) [TaxId:3891] [187454] (9 PDB entries)
  8. 952004Domain d3qyda_: 3qyd A: [184692]
    automated match to d1wbca_

Details for d3qyda_

PDB Entry: 3qyd (more details), 2.97 Å

PDB Description: Crystal structure of a recombinant chimeric trypsin inhibitor
PDB Compounds: (A:) Chymotrypsin inhibitor 3

SCOPe Domain Sequences for d3qyda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qyda_ b.42.4.1 (A:) automated matches {Winged bean (Psophocarpus tetragonolobus) [TaxId: 3891]}
dddlvdaegnlvenggtyyllphiwahgggietaktgnepcpltvvrspnevskgepiri
ssrlrsafiprgslvrlgfanppscaaspwwtvvdspqgpavklsqqklpekdiyvfkfe
kvshsnihvykllycqhdeedvkcdqyigihrdrngnrrlvvteenplelvllkaks

SCOPe Domain Coordinates for d3qyda_:

Click to download the PDB-style file with coordinates for d3qyda_.
(The format of our PDB-style files is described here.)

Timeline for d3qyda_: