![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
![]() | Family d.38.1.1: 4HBT-like [54638] (19 proteins) Pfam PF03061 |
![]() | Protein Hypothetical protein PA2801 [143162] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [143163] (1 PDB entry) Uniprot Q9I042 5-134 |
![]() | Domain d3qy3a1: 3qy3 A:5-134 [184690] complexed with cl |
PDB Entry: 3qy3 (more details), 1.75 Å
SCOPe Domain Sequences for d3qy3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qy3a1 d.38.1.1 (A:5-134) Hypothetical protein PA2801 {Pseudomonas aeruginosa [TaxId: 287]} qllhtahipvrwgdmdsyghvnntlyfqyleearvawfetlgidlegaaegpvvlqslht ylkpvvhpatvvvelyagrlgtsslvlehrlhtledpqgtygeghcklvwvrhaenrstp vpdsiraaia
Timeline for d3qy3a1: