Lineage for d3qy1b_ (3qy1 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883013Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883078Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2883079Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)
  6. 2883111Protein automated matches [190278] (5 species)
    not a true protein
  7. 2883184Species Salmonella enterica [TaxId:99287] [189672] (1 PDB entry)
  8. 2883186Domain d3qy1b_: 3qy1 B: [184689]
    automated match to d1i6ob_
    complexed with zn

Details for d3qy1b_

PDB Entry: 3qy1 (more details), 1.54 Å

PDB Description: 1.54A Resolution Crystal Structure of a Beta-Carbonic Anhydrase from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
PDB Compounds: (B:) carbonic anhydrase

SCOPe Domain Sequences for d3qy1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qy1b_ c.53.2.1 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
vhrnvanlvihtdlnclsvvqyavdvlevehiiicghsgcggikaavenpelglinnwll
hirdiwlkhssllgkmpeeqrldalyelnvmeqvynlghstimqsawkrgqnvtihgway
sindgllrdldvtatnretlengyhkgisalslkyi

SCOPe Domain Coordinates for d3qy1b_:

Click to download the PDB-style file with coordinates for d3qy1b_.
(The format of our PDB-style files is described here.)

Timeline for d3qy1b_: