SCOPe 2.08: Domain d3qy1b_: 3qy1 B:

Lineage for d3qy1b_ (3qy1 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.53: Resolvase-like [53040] (2 superfamilies)
   Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families)

5. Family c.53.2.1: beta-carbonic anhydrase, cab [53057] (2 proteins)

6. Protein automated matches [190278] (5 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [189672] (1 PDB entry)

8. Domain d3qy1b_: 3qy1 B: [184689]
   automated match to d1i6ob_
   complexed with zn

Details for d3qy1b_

PDB Entry: 3qy1, 1.54 Å

PDB Description: 1.54A Resolution Crystal Structure of a Beta-Carbonic Anhydrase from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2

PDB Compounds: (B:) carbonic anhydrase

SCOPe Domain Sequences for d3qy1b_:

Sequence; same for both SEQRES and ATOM records:

>d3qy1b_ c.53.2.1 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
kdidtlisnnalwskmlveedpgffeklaqaqkprflwigcsdsrvpaerltglepgelf
vhrnvanlvihtdlnclsvvqyavdvlevehiiicghsgcggikaavenpelglinnwll
hirdiwlkhssllgkmpeeqrldalyelnvmeqvynlghstimqsawkrgqnvtihgway
sindgllrdldvtatnretlengyhkgisalslkyi

Timeline for d3qy1b_:

• d3qy1b_ first appeared in SCOPe 2.01
  
• d3qy1b_ appears in SCOPe 2.07