Lineage for d3qxzc1 (3qxz C:3-260)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100284Species Mycobacterium abscessus [TaxId:561007] [189671] (6 PDB entries)
  8. 2100287Domain d3qxzc1: 3qxz C:3-260 [184687]
    Other proteins in same PDB: d3qxza2, d3qxzb2, d3qxzc2
    automated match to d1uiya_
    complexed with edo, gol, k

Details for d3qxzc1

PDB Entry: 3qxz (more details), 1.35 Å

PDB Description: crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus
PDB Compounds: (C:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3qxzc1:

Sequence, based on SEQRES records: (download)

>d3qxzc1 c.14.1.0 (C:3-260) automated matches {Mycobacterium abscessus [TaxId: 561007]}
telheeirdgvavltlhgpstrnsftvelgrqlgaayqrldddpavrvivltgappafcs
gaqisaaaetfaaprnpdfsaspvqpaafelrtpviaavnghaigigmtlalhadirila
eegryaipqvrfgvapdalahwtlprlvgtavaaellltgasfsaqravetglanrclpa
gkvlgaalrmahdiatnvapesaaltkrllwdaqmtgmsaaevaaretadhlrlmgsqda
aegprafidgrpprwagq

Sequence, based on observed residues (ATOM records): (download)

>d3qxzc1 c.14.1.0 (C:3-260) automated matches {Mycobacterium abscessus [TaxId: 561007]}
telheeirdgvavltlhgpstrnsftvelgrqlgaayqrldddpavrvivltgappafcs
gaqisafsaspvqpaafelrtpviaavnghaigigmtlalhadirilaeegryaipqvrf
gvapdalahwtlprlvgtavaaellltgasfsaqravetglanrclpagkvlgaalrmah
diatnvapesaaltkrllwdaqmtgmsaaevaaretadhlrlmgsqdaaegprafidgrp
prwagq

SCOPe Domain Coordinates for d3qxzc1:

Click to download the PDB-style file with coordinates for d3qxzc1.
(The format of our PDB-style files is described here.)

Timeline for d3qxzc1: