SCOPe 2.03: Domain d3qxtb_: 3qxt B:

Lineage for d3qxtb_ (3qxt B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (16 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (60 PDB entries)

8. Domain d3qxtb_: 3qxt B: [184684]
   automated match to d1ol0a_
   complexed with mtx, na

Details for d3qxtb_

PDB Entry: 3qxt, 1.7 Å

PDB Description: Structure of an Anti-Methotrexate CDR1-3 Graft VHH Antibody in Complex with Methotrexate

PDB Compounds: (B:) Anti-Methotrexate CDR1-3 Graft VHH

SCOPe Domain Sequences for d3qxtb_:

Sequence; same for both SEQRES and ATOM records:

>d3qxtb_ b.1.1.1 (B:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrltty
gdsvkgrftisrdkgkntvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqv
tvss

Timeline for d3qxtb_:

• d3qxtb_ first appeared in SCOPe 2.01
  
• d3qxtb_ appears in SCOPe 2.02
  
• d3qxtb_ appears in SCOPe 2.04
  
• d3qxtb_ appears in the current release, SCOPe 2.08