Lineage for d3qxta_ (3qxt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2743671Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
  8. 2743696Domain d3qxta_: 3qxt A: [184683]
    automated match to d1ol0a_
    complexed with mtx, na

Details for d3qxta_

PDB Entry: 3qxt (more details), 1.7 Å

PDB Description: Structure of an Anti-Methotrexate CDR1-3 Graft VHH Antibody in Complex with Methotrexate
PDB Compounds: (A:) Anti-Methotrexate CDR1-3 Graft VHH

SCOPe Domain Sequences for d3qxta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qxta_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscaasrrssrswamawfrqapgkerefvakisgdgrltty
gdsvkgrftisrdkgkntvylqmdslkpedtavyycaaddnyvtaswrsgpdywgqgtqv
tvss

SCOPe Domain Coordinates for d3qxta_:

Click to download the PDB-style file with coordinates for d3qxta_.
(The format of our PDB-style files is described here.)

Timeline for d3qxta_: