Lineage for d3qxeh_ (3qxe H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2054490Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2054583Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2054584Protein automated matches [191237] (4 species)
    not a true protein
  7. 2054624Species Pseudomonas putida [TaxId:303] [189678] (5 PDB entries)
  8. 2054632Domain d3qxeh_: 3qxe H: [184682]
    Other proteins in same PDB: d3qxea_, d3qxec_, d3qxee_, d3qxeg_
    automated match to d1ugpb_
    complexed with 3co, gol

Details for d3qxeh_

PDB Entry: 3qxe (more details), 2.1 Å

PDB Description: crystal structure of co-type nitrile hydratase from pseudomonas putida.
PDB Compounds: (H:) Co-type Nitrile Hydratase beta subunit

SCOPe Domain Sequences for d3qxeh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qxeh_ b.34.4.0 (H:) automated matches {Pseudomonas putida [TaxId: 303]}
mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp
ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas
aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge
hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa

SCOPe Domain Coordinates for d3qxeh_:

Click to download the PDB-style file with coordinates for d3qxeh_.
(The format of our PDB-style files is described here.)

Timeline for d3qxeh_: