Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
Protein automated matches [191237] (4 species) not a true protein |
Species Pseudomonas putida [TaxId:303] [189678] (5 PDB entries) |
Domain d3qxed_: 3qxe D: [184680] Other proteins in same PDB: d3qxea_, d3qxec_, d3qxee_, d3qxeg_ automated match to d1ugpb_ complexed with 3co, gol |
PDB Entry: 3qxe (more details), 2.1 Å
SCOPe Domain Sequences for d3qxed_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qxed_ b.34.4.0 (D:) automated matches {Pseudomonas putida [TaxId: 303]} mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa
Timeline for d3qxed_: