SCOPe 2.01: Domain d3qxed_: 3qxe D:

Lineage for d3qxed_ (3qxe D:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.0: automated matches [191659] (1 protein)
   not a true family

6. Protein automated matches [191237] (1 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [189678] (5 PDB entries)

8. Domain d3qxed_: 3qxe D: [184680]
   automated match to d1ugpb_
   complexed with 3co, gol

Details for d3qxed_

PDB Entry: 3qxe, 2.1 Å

PDB Description: crystal structure of co-type nitrile hydratase from pseudomonas putida.

PDB Compounds: (D:) Co-type Nitrile Hydratase beta subunit

SCOPe Domain Sequences for d3qxed_:

Sequence; same for both SEQRES and ATOM records:

>d3qxed_ b.34.4.0 (D:) automated matches {Pseudomonas putida [TaxId: 303]}
mngihdtggahgygpvyrepnepvfrydwektvmsllpallangnfnldefrhsiermgp
ahylegtyyehwlhvfenllvekgvltatevatgkaasgktatpvltpaivdgllstgas
aareegararfavgdkvrvlnknpvghtrmprytrgkvgtvvidhgvfvtpdtaahgkge
hpqhvytvsftsvelwgqdasspkdtirvdlwddylepa

Timeline for d3qxed_:

• d3qxed_ is new in SCOPe 2.01-stable
  
• d3qxed_ appears in SCOPe 2.02
  
• d3qxed_ appears in the current release, SCOPe 2.08