SCOP 1.57: Domain d1qk1c1: 1qk1 C:1-102

Lineage for d1qk1c1 (1qk1 C:1-102)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.83: Guanido kinases [48033] (1 superfamily)

4. Superfamily a.83.1: Guanido kinases [48034] (1 family)

5. Family a.83.1.1: Guanido kinases [48035] (2 proteins)

6. Protein Creatine kinase, N-terminal domain [48036] (5 species)

7. Species Human (Homo sapiens), mitochondria [TaxId:9606] [48039] (1 PDB entry)

8. Domain d1qk1c1: 1qk1 C:1-102 [18468]
   Other proteins in same PDB: d1qk1a2, d1qk1b2, d1qk1c2, d1qk1d2, d1qk1e2, d1qk1f2, d1qk1g2, d1qk1h2

Details for d1qk1c1

PDB Entry: 1qk1, 2.7 Å

PDB Description: crystal structure of human ubiquitous mitochondrial creatine kinase

SCOP Domain Sequences for d1qk1c1:

Sequence; same for both SEQRES and ATOM records:

>d1qk1c1 a.83.1.1 (C:1-102) Creatine kinase, N-terminal domain {Human (Homo sapiens), mitochondria}
aaserrrlyppsaeypdlrkhnncmashltpavyarlcdkttptgwtldqciqtgvdnpg
hpfiktvgmvagdeetyevfadlfdpviqerhngydprtmkh

Timeline for d1qk1c1:

• d1qk1c1 first appeared (with stable ids) in SCOP 1.55
  
• d1qk1c1 appears in SCOP 1.59
  
• d1qk1c1 appears in the current release, SCOPe 2.08