Lineage for d3qwop_ (3qwo P:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1261719Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1261720Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) (S)
  5. 1261721Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 1261741Protein automated matches [191290] (2 species)
    not a true protein
  7. 1261742Species Staphylococcus aureus [TaxId:1280] [189943] (1 PDB entry)
  8. 1261744Domain d3qwop_: 3qwo P: [184678]
    Other proteins in same PDB: d3qwob1, d3qwob2, d3qwol1, d3qwol2
    automated match to d1h0ta_
    complexed with edo, so4

Details for d3qwop_

PDB Entry: 3qwo (more details), 1.9 Å

PDB Description: Crystal structure of a motavizumab epitope-scaffold bound to motavizumab Fab
PDB Compounds: (P:) motavizumab epitope scaffold

SCOPe Domain Sequences for d3qwop_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qwop_ a.8.1.1 (P:) automated matches {Staphylococcus aureus [TaxId: 1280]}
syndekklasneianlpnlneeqrsaflssinddpsqsanllaeakklndaqa

SCOPe Domain Coordinates for d3qwop_:

Click to download the PDB-style file with coordinates for d3qwop_.
(The format of our PDB-style files is described here.)

Timeline for d3qwop_: