Class a: All alpha proteins [46456] (284 folds) |
Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (2 families) |
Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins) |
Protein automated matches [191290] (1 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [189943] (1 PDB entry) |
Domain d3qwop_: 3qwo P: [184678] automated match to d1h0ta_ complexed with edo, so4 |
PDB Entry: 3qwo (more details), 1.9 Å
SCOPe Domain Sequences for d3qwop_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qwop_ a.8.1.1 (P:) automated matches {Staphylococcus aureus [TaxId: 1280]} syndekklasneianlpnlneeqrsaflssinddpsqsanllaeakklndaqa
Timeline for d3qwop_: