Lineage for d3qwoc_ (3qwo C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2696963Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2696964Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2697064Protein automated matches [191290] (5 species)
    not a true protein
  7. 2697072Species Staphylococcus aureus [TaxId:1280] [189943] (16 PDB entries)
  8. 2697080Domain d3qwoc_: 3qwo C: [184677]
    Other proteins in same PDB: d3qwoa_, d3qwob1, d3qwob2, d3qwoh_, d3qwol1, d3qwol2
    automated match to d1h0ta_
    complexed with edo, so4

Details for d3qwoc_

PDB Entry: 3qwo (more details), 1.9 Å

PDB Description: Crystal structure of a motavizumab epitope-scaffold bound to motavizumab Fab
PDB Compounds: (C:) motavizumab epitope scaffold

SCOPe Domain Sequences for d3qwoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qwoc_ a.8.1.1 (C:) automated matches {Staphylococcus aureus [TaxId: 1280]}
syndekklasneianlpnlneeqrsaflssinddpsqsanllaeakklndaqa

SCOPe Domain Coordinates for d3qwoc_:

Click to download the PDB-style file with coordinates for d3qwoc_.
(The format of our PDB-style files is described here.)

Timeline for d3qwoc_: