Lineage for d3qwdn_ (3qwd N:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460794Protein automated matches [190149] (15 species)
    not a true protein
  7. 2461182Species Staphylococcus aureus [TaxId:93061] [189958] (9 PDB entries)
  8. 2461196Domain d3qwdn_: 3qwd N: [184676]
    Other proteins in same PDB: d3qwdc2, d3qwdh2, d3qwdi2
    automated match to d1tyfa_
    complexed with cl

Details for d3qwdn_

PDB Entry: 3qwd (more details), 2.1 Å

PDB Description: Crystal structure of ClpP from Staphylococcus aureus
PDB Compounds: (N:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3qwdn_:

Sequence, based on SEQRES records: (download)

>d3qwdn_ c.14.1.1 (N:) automated matches {Staphylococcus aureus [TaxId: 93061]}
liptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyl
yinspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmi
hqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeake
yglidevmvpe

Sequence, based on observed residues (ATOM records): (download)

>d3qwdn_ c.14.1.1 (N:) automated matches {Staphylococcus aureus [TaxId: 93061]}
liptvieraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspg
gsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplgg
aqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevm
vpe

SCOPe Domain Coordinates for d3qwdn_:

Click to download the PDB-style file with coordinates for d3qwdn_.
(The format of our PDB-style files is described here.)

Timeline for d3qwdn_: