![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
![]() | Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
![]() | Protein Creatine kinase, N-domain [48036] (7 species) |
![]() | Species Human (Homo sapiens), mitochondria [TaxId:9606] [48039] (1 PDB entry) |
![]() | Domain d1qk1b1: 1qk1 B:1-102 [18467] Other proteins in same PDB: d1qk1a2, d1qk1b2, d1qk1c2, d1qk1d2, d1qk1e2, d1qk1f2, d1qk1g2, d1qk1h2 complexed with po4 |
PDB Entry: 1qk1 (more details), 2.7 Å
SCOPe Domain Sequences for d1qk1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qk1b1 a.83.1.1 (B:1-102) Creatine kinase, N-domain {Human (Homo sapiens), mitochondria [TaxId: 9606]} aaserrrlyppsaeypdlrkhnncmashltpavyarlcdkttptgwtldqciqtgvdnpg hpfiktvgmvagdeetyevfadlfdpviqerhngydprtmkh
Timeline for d1qk1b1: