Lineage for d1qk1a1 (1qk1 A:1-102)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719234Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2719235Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2719236Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 2719264Protein Creatine kinase, N-domain [48036] (7 species)
  7. 2719277Species Human (Homo sapiens), mitochondria [TaxId:9606] [48039] (1 PDB entry)
  8. 2719278Domain d1qk1a1: 1qk1 A:1-102 [18466]
    Other proteins in same PDB: d1qk1a2, d1qk1b2, d1qk1c2, d1qk1d2, d1qk1e2, d1qk1f2, d1qk1g2, d1qk1h2
    complexed with po4

Details for d1qk1a1

PDB Entry: 1qk1 (more details), 2.7 Å

PDB Description: crystal structure of human ubiquitous mitochondrial creatine kinase
PDB Compounds: (A:) creatine kinase, ubiquitous mitochondrial

SCOPe Domain Sequences for d1qk1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qk1a1 a.83.1.1 (A:1-102) Creatine kinase, N-domain {Human (Homo sapiens), mitochondria [TaxId: 9606]}
aaserrrlyppsaeypdlrkhnncmashltpavyarlcdkttptgwtldqciqtgvdnpg
hpfiktvgmvagdeetyevfadlfdpviqerhngydprtmkh

SCOPe Domain Coordinates for d1qk1a1:

Click to download the PDB-style file with coordinates for d1qk1a1.
(The format of our PDB-style files is described here.)

Timeline for d1qk1a1: