Lineage for d3qvzd_ (3qvz D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988268Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1988318Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1988319Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 1988331Protein automated matches [190502] (2 species)
    not a true protein
  7. 1988332Species Escherichia coli [TaxId:562] [187450] (39 PDB entries)
  8. 1988473Domain d3qvzd_: 3qvz D: [184654]
    automated match to d1qq3a_
    complexed with cu, hem, me7, zn

Details for d3qvzd_

PDB Entry: 3qvz (more details), 2.64 Å

PDB Description: Crystal structure of the Zn-RIDC1 complex stabilized by BMOE crosslinks cocrystallized in the presence of Cu(II)
PDB Compounds: (D:) Cytochrome cb562

SCOPe Domain Sequences for d3qvzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvzd_ a.24.3.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlaneckvkeaqaaaeqlkttcnachqkyr

SCOPe Domain Coordinates for d3qvzd_:

Click to download the PDB-style file with coordinates for d3qvzd_.
(The format of our PDB-style files is described here.)

Timeline for d3qvzd_: