Lineage for d3qvzb_ (3qvz B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2699500Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2699501Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 2699739Protein automated matches [190502] (2 species)
    not a true protein
  7. 2699740Species Escherichia coli [TaxId:562] [187450] (15 PDB entries)
  8. 2699779Domain d3qvzb_: 3qvz B: [184652]
    automated match to d1qq3a_
    complexed with cu, hem, me7, zn

Details for d3qvzb_

PDB Entry: 3qvz (more details), 2.64 Å

PDB Description: Crystal structure of the Zn-RIDC1 complex stabilized by BMOE crosslinks cocrystallized in the presence of Cu(II)
PDB Compounds: (B:) Cytochrome cb562

SCOPe Domain Sequences for d3qvzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvzb_ a.24.3.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlaneckvkeaqaaaeqlkttcnachqkyr

SCOPe Domain Coordinates for d3qvzb_:

Click to download the PDB-style file with coordinates for d3qvzb_.
(The format of our PDB-style files is described here.)

Timeline for d3qvzb_: