SCOP 1.75: Domain d1qh4d1: 1qh4 D:2-102

Lineage for d1qh4d1 (1qh4 D:2-102)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family)

5. Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)

6. Protein Creatine kinase, N-domain [48036] (7 species)

7. Species Chicken (Gallus gallus), brain-type [TaxId:9031] [48038] (1 PDB entry)

8. Domain d1qh4d1: 1qh4 D:2-102 [18465]
   Other proteins in same PDB: d1qh4a2, d1qh4b2, d1qh4c2, d1qh4d2

Details for d1qh4d1

PDB Entry: 1qh4, 1.41 Å

PDB Description: crystal structure of chicken brain-type creatine kinase at 1.41 angstrom resolution

PDB Compounds: (D:) creatine kinase

SCOP Domain Sequences for d1qh4d1:

Sequence; same for both SEQRES and ATOM records:

>d1qh4d1 a.83.1.1 (D:2-102) Creatine kinase, N-domain {Chicken (Gallus gallus), brain-type [TaxId: 9031]}
pfsnshnllkmkysvddeypdlsvhnnhmakvltldlykklrdrqtssgftlddviqtgv
dnpghpfimtvgcvagdeesyevfkelfdpviedrhggykp

Timeline for d1qh4d1:

• d1qh4d1 first appeared (with stable ids) in SCOP 1.55
  
• d1qh4d1 appears in SCOP 1.73
  
• d1qh4d1 appears in SCOPe 2.01
  
• d1qh4d1 appears in the current release, SCOPe 2.08