| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
| Family a.24.3.1: Cytochrome b562 [47176] (2 proteins) automatically mapped to Pfam PF07361 |
| Protein automated matches [190502] (2 species) not a true protein |
| Species Escherichia coli [TaxId:562] [187450] (15 PDB entries) |
| Domain d3qvyc_: 3qvy C: [184649] automated match to d1qq3a_ complexed with hem, me7, zn |
PDB Entry: 3qvy (more details), 2.3 Å
SCOPe Domain Sequences for d3qvyc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qvyc_ a.24.3.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlaneckvkeaqaaaeqlkttcnachqkyr
Timeline for d3qvyc_: