Lineage for d3qvgd1 (3qvg D:531-631)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2854448Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2854449Superfamily c.15.1: BRCT domain [52113] (6 families) (S)
    Pfam PF00533
  5. 2854450Family c.15.1.1: DNA-repair protein XRCC1 [52114] (2 proteins)
  6. 2854457Protein automated matches [191251] (1 species)
    not a true protein
  7. 2854458Species Mouse (Mus musculus) [TaxId:10090] [189783] (3 PDB entries)
  8. 2854464Domain d3qvgd1: 3qvg D:531-631 [184646]
    Other proteins in same PDB: d3qvga1, d3qvga2, d3qvgb2, d3qvgc1, d3qvgc2, d3qvgd2
    automated match to d1cdza_
    protein/DNA complex

Details for d3qvgd1

PDB Entry: 3qvg (more details), 2.26 Å

PDB Description: xrcc1 bound to dna ligase
PDB Compounds: (D:) DNA repair protein XRCC1

SCOPe Domain Sequences for d3qvgd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvgd1 c.15.1.1 (D:531-631) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlpvpelpdffegkhfflygefpgderrrliryvtafngeledrmnervqfvitaqewdp
nfeealmenpslafvrprwiyscnekqkllphqlygvvpqa

SCOPe Domain Coordinates for d3qvgd1:

Click to download the PDB-style file with coordinates for d3qvgd1.
(The format of our PDB-style files is described here.)

Timeline for d3qvgd1: