SCOPe 2.08: Domain d3qvgc1: 3qvg C:846-921

Lineage for d3qvgc1 (3qvg C:846-921)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.15: BRCT domain [52112] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.15.1: BRCT domain [52113] (6 families)
   Pfam PF00533

5. Family c.15.1.2: DNA ligase [52117] (3 proteins)

6. Protein automated matches [191252] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189784] (4 PDB entries)

8. Domain d3qvgc1: 3qvg C:846-921 [184645]
   Other proteins in same PDB: d3qvga2, d3qvgb1, d3qvgb2, d3qvgc2, d3qvgd1, d3qvgd2
   automated match to d1imoa_
   protein/DNA complex

Details for d3qvgc1

PDB Entry: 3qvg, 2.26 Å

PDB Description: xrcc1 bound to dna ligase

PDB Compounds: (C:) DNA ligase 3

SCOPe Domain Sequences for d3qvgc1:

Sequence; same for both SEQRES and ATOM records:

>d3qvgc1 c.15.1.2 (C:846-921) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlldiftgvrlylppstpdfsrlrryfvafdgdlvqefdmtsathvlgsrdknpaaqqvs
pewiwacirkrrlvap

Timeline for d3qvgc1:

• d3qvgc1 first appeared in SCOPe 2.01, called d3qvgc_
  
• d3qvgc1 appears in SCOPe 2.07