Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.15: BRCT domain [52112] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.15.1: BRCT domain [52113] (5 families) Pfam PF00533 |
Family c.15.1.2: DNA ligase [52117] (3 proteins) |
Protein automated matches [191252] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189784] (3 PDB entries) |
Domain d3qvga_: 3qvg A: [184643] Other proteins in same PDB: d3qvgb_, d3qvgd_ automated match to d1imoa_ protein/DNA complex |
PDB Entry: 3qvg (more details), 2.26 Å
SCOPe Domain Sequences for d3qvga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qvga_ c.15.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lcqtkvlldiftgvrlylppstpdfsrlrryfvafdgdlvqefdmtsathvlgsrdknpa aqqvspewiwacirkrrlvaps
Timeline for d3qvga_: