Lineage for d3qvga_ (3qvg A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 981440Fold c.15: BRCT domain [52112] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 981441Superfamily c.15.1: BRCT domain [52113] (5 families) (S)
    Pfam PF00533
  5. 981454Family c.15.1.2: DNA ligase [52117] (3 proteins)
  6. 981462Protein automated matches [191252] (1 species)
    not a true protein
  7. 981463Species Human (Homo sapiens) [TaxId:9606] [189784] (3 PDB entries)
  8. 981466Domain d3qvga_: 3qvg A: [184643]
    Other proteins in same PDB: d3qvgb_, d3qvgd_
    automated match to d1imoa_
    protein/DNA complex

Details for d3qvga_

PDB Entry: 3qvg (more details), 2.26 Å

PDB Description: xrcc1 bound to dna ligase
PDB Compounds: (A:) DNA ligase 3

SCOPe Domain Sequences for d3qvga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvga_ c.15.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lcqtkvlldiftgvrlylppstpdfsrlrryfvafdgdlvqefdmtsathvlgsrdknpa
aqqvspewiwacirkrrlvaps

SCOPe Domain Coordinates for d3qvga_:

Click to download the PDB-style file with coordinates for d3qvga_.
(The format of our PDB-style files is described here.)

Timeline for d3qvga_: