Lineage for d1qh4c1 (1qh4 C:2-102)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719234Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 2719235Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 2719236Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)
  6. 2719264Protein Creatine kinase, N-domain [48036] (7 species)
  7. 2719265Species Chicken (Gallus gallus), brain-type [TaxId:9031] [48038] (1 PDB entry)
  8. 2719268Domain d1qh4c1: 1qh4 C:2-102 [18464]
    Other proteins in same PDB: d1qh4a2, d1qh4b2, d1qh4c2, d1qh4d2
    complexed with act, ca

Details for d1qh4c1

PDB Entry: 1qh4 (more details), 1.41 Å

PDB Description: crystal structure of chicken brain-type creatine kinase at 1.41 angstrom resolution
PDB Compounds: (C:) creatine kinase

SCOPe Domain Sequences for d1qh4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qh4c1 a.83.1.1 (C:2-102) Creatine kinase, N-domain {Chicken (Gallus gallus), brain-type [TaxId: 9031]}
pfsnshnllkmkysvddeypdlsvhnnhmakvltldlykklrdrqtssgftlddviqtgv
dnpghpfimtvgcvagdeesyevfkelfdpviedrhggykp

SCOPe Domain Coordinates for d1qh4c1:

Click to download the PDB-style file with coordinates for d1qh4c1.
(The format of our PDB-style files is described here.)

Timeline for d1qh4c1: