| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.23: Interferon regulatory factor [46877] (4 proteins) Pfam PF00605 |
| Protein automated matches [191301] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189980] (1 PDB entry) |
| Domain d3qu6a_: 3qu6 A: [184629] automated match to d1t2ka_ complexed with cl, na, zn |
PDB Entry: 3qu6 (more details), 2.3 Å
SCOPe Domain Sequences for d3qu6a_:
Sequence, based on SEQRES records: (download)
>d3qu6a_ a.4.5.23 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprilpwlvsqldlgqlegvawvnksrtrfripwkhglrqdaqqedfgifqawaeatgay
vpgrdkpdlptwkrnfrsamnrkeglrlaedrskdphdphkiyefv
>d3qu6a_ a.4.5.23 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprilpwlvsqldlgqlegvawvnksrtrfripwkhedfgifqawaeatgayvpgrdkpd
lptwkrnfrsamnrkeglrlaedrskdphdphkiyefv
Timeline for d3qu6a_: