Lineage for d3qu3b_ (3qu3 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308302Species Mouse (Mus musculus) [TaxId:10090] [189892] (3 PDB entries)
  8. 2308304Domain d3qu3b_: 3qu3 B: [184627]
    automated match to d1t2ka_
    complexed with edo, na

Details for d3qu3b_

PDB Entry: 3qu3 (more details), 1.3 Å

PDB Description: Crystal structure of IRF-7 DBD apo form
PDB Compounds: (B:) Interferon regulatory factor 7

SCOPe Domain Sequences for d3qu3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qu3b_ a.4.5.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rvlfgdwllgevssgqyeglqwlneartvfrvpwkhfgrrdldeedaqifkawavargrw
ppsgvnlpppeaeaaerrerrgwktnfrcalhstgrfilrqdnsgdpvdphkvyels

SCOPe Domain Coordinates for d3qu3b_:

Click to download the PDB-style file with coordinates for d3qu3b_.
(The format of our PDB-style files is described here.)

Timeline for d3qu3b_: