SCOPe 2.06: Domain d3qtlc_: 3qtl C:

Lineage for d3qtlc_ (3qtl C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (14 proteins)

6. Protein automated matches [190073] (15 species)
   not a true protein

7. Species Bacillus licheniformis [TaxId:1402] [186887] (7 PDB entries)

8. Domain d3qtlc_: 3qtl C: [184623]
   automated match to d1af4a_

Details for d3qtlc_

PDB Entry: 3qtl, 2.6 Å

PDB Description: structural basis for dual-inhibition mechanism of a non-classical kazal-type serine protease inhibitor from horseshoe crab in complex with subtilisin

PDB Compounds: (C:) Subtilisin-like serin protease

SCOPe Domain Sequences for d3qtlc_:

Sequence; same for both SEQRES and ATOM records:

>d3qtlc_ c.41.1.1 (C:) automated matches {Bacillus licheniformis [TaxId: 1402]}
aqtvpygiplikadkvqaqgfkganvkvavldtgiqashpdlnvvggasfvageayntdg
nghgthvagtvaaldnttgvlgvapsvslyavkvlnssgsgsysgivsgiewattngmdv
inmslggasgstamkqavdnayargvvvvaaagnsgssgntntigypakydsviavgavd
snsnrasfssvgaelevmapgagvystyptntyatlngtsmasphvagaaalilskhpnl
sasqvrnrlsstatylgssfyygkglinveaaaq

Timeline for d3qtlc_:

• d3qtlc_ first appeared in SCOPe 2.01
  
• d3qtlc_ appears in SCOPe 2.05
  
• d3qtlc_ appears in SCOPe 2.07
  
• d3qtlc_ appears in the current release, SCOPe 2.08