Lineage for d3qtlc_ (3qtl C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2114952Family c.41.1.1: Subtilases [52744] (14 protein domains)
  6. 2115138Protein automated matches [190073] (15 species)
    not a true protein
  7. 2115165Species Bacillus licheniformis [TaxId:1402] [186887] (7 PDB entries)
  8. 2115176Domain d3qtlc_: 3qtl C: [184623]
    automated match to d1af4a_

Details for d3qtlc_

PDB Entry: 3qtl (more details), 2.6 Å

PDB Description: Structural Basis for Dual-inhibition Mechanism of a Non-classical Kazal-type Serine Protease Inhibitor from Horseshoe Crab in Complex with Subtilisin
PDB Compounds: (C:) Subtilisin-like serin protease

SCOPe Domain Sequences for d3qtlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qtlc_ c.41.1.1 (C:) automated matches {Bacillus licheniformis [TaxId: 1402]}
aqtvpygiplikadkvqaqgfkganvkvavldtgiqashpdlnvvggasfvageayntdg
nghgthvagtvaaldnttgvlgvapsvslyavkvlnssgsgsysgivsgiewattngmdv
inmslggasgstamkqavdnayargvvvvaaagnsgssgntntigypakydsviavgavd
snsnrasfssvgaelevmapgagvystyptntyatlngtsmasphvagaaalilskhpnl
sasqvrnrlsstatylgssfyygkglinveaaaq

SCOPe Domain Coordinates for d3qtlc_:

Click to download the PDB-style file with coordinates for d3qtlc_.
(The format of our PDB-style files is described here.)

Timeline for d3qtlc_: