SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3qtlc_ (3qtl C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2114952Family c.41.1.1: Subtilases [52744] (14 protein domains)
  6. 2115138Protein automated matches [190073] (15 species)
    not a true protein
  7. 2115165Species Bacillus licheniformis [TaxId:1402] [186887] (7 PDB entries)
  8. 2115176Domain d3qtlc_: 3qtl C: [184623]
    automated match to d1af4a_

Details for d3qtlc_

PDB Entry: 3qtl (more details), 2.6 Å

PDB Description: Structural Basis for Dual-inhibition Mechanism of a Non-classical Kazal-type Serine Protease Inhibitor from Horseshoe Crab in Complex with Subtilisin
PDB Compounds: (C:) Subtilisin-like serin protease

SCOPe Domain Sequences for d3qtlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qtlc_ c.41.1.1 (C:) automated matches {Bacillus licheniformis [TaxId: 1402]}
aqtvpygiplikadkvqaqgfkganvkvavldtgiqashpdlnvvggasfvageayntdg
nghgthvagtvaaldnttgvlgvapsvslyavkvlnssgsgsysgivsgiewattngmdv
inmslggasgstamkqavdnayargvvvvaaagnsgssgntntigypakydsviavgavd
snsnrasfssvgaelevmapgagvystyptntyatlngtsmasphvagaaalilskhpnl
sasqvrnrlsstatylgssfyygkglinveaaaq

SCOPe Domain Coordinates for d3qtlc_:

Click to download the PDB-style file with coordinates for d3qtlc_.
(The format of our PDB-style files is described here.)

Timeline for d3qtlc_: