SCOPe 2.08: Domain d3qt9a_: 3qt9 A:

Lineage for d3qt9a_ (3qt9 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.8: CPF0428-like [158737] (3 proteins)
   Pfam PF06824; DUF1237

6. Protein Hypothetical protein CPF0428 [158740] (2 species)

7. Species Clostridium perfringens [TaxId:1502] [158741] (3 PDB entries)
   Uniprot Q0TU05 2-427

8. Domain d3qt9a_: 3qt9 A: [184618]
   automated match to d2nvpa1
   complexed with edo

Details for d3qt9a_

PDB Entry: 3qt9, 2.05 Å

PDB Description: analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of n-linked glycans, clostridium perfringens cpe0426 complexed with alpha-1,6- linked 1-thio-alpha-mannobiose

PDB Compounds: (A:) Putative uncharacterized protein CPE0426

SCOPe Domain Sequences for d3qt9a_:

Sequence; same for both SEQRES and ATOM records:

>d3qt9a_ a.102.1.8 (A:) Hypothetical protein CPF0428 {Clostridium perfringens [TaxId: 1502]}
lstnelkeivrkigkdlsgkiedkklqelfyncfintmdttvevsegdafvitgdipamw
lrdstsqvehylpfvkeypelkaiftglinrqvkcifidpyanafnkepngqkwdnditk
dspwvwerkyeidslcypvrlihkywkesgdetffnydikkafnmiidlwrveqyhreks
dysfqrlncsvtdtlsheglgtpvtytgmtwsgfrpsddaceygylipanmfavvalryi
seiaekvykdeelkekadslreeidnaiekhgkvykegfgevyayetdgmgnynfmddan
vpsllsipyleykgiedevyqntrkfilsknnrfffegkaakgigsphtpdqyiwhials
mqglttnnqeeidqlikllketdagtgymhegfhvddptkftrdwfawsnslfshfiyek
vink

Timeline for d3qt9a_:

• d3qt9a_ first appeared in SCOPe 2.01
  
• d3qt9a_ appears in SCOPe 2.07