Lineage for d3qt3a_ (3qt3 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722269Family a.102.1.8: CPF0428-like [158737] (3 proteins)
    Pfam PF06824; DUF1237
  6. 2722274Protein Hypothetical protein CPF0428 [158740] (2 species)
  7. 2722275Species Clostridium perfringens [TaxId:1502] [158741] (3 PDB entries)
    Uniprot Q0TU05 2-427
  8. 2722278Domain d3qt3a_: 3qt3 A: [184617]
    automated match to d2nvpa1
    complexed with edo

Details for d3qt3a_

PDB Entry: 3qt3 (more details), 2.35 Å

PDB Description: analysis of a new family of widely distributed metal-independent alpha-mannosidases provides unique insight into the processing of n- linked glycans, clostridium perfringens cpe0426 apo-structure
PDB Compounds: (A:) Putative uncharacterized protein CPE0426

SCOPe Domain Sequences for d3qt3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qt3a_ a.102.1.8 (A:) Hypothetical protein CPF0428 {Clostridium perfringens [TaxId: 1502]}
slstnelkeivrkigkdlsgkiedkklqelfyncfintmdttvevsegdafvitgdipam
wlrdstsqvehylpfvkeypelkaiftglinrqvkcifidpyanafnkepngqkwdndit
kdspwvwerkyeidslcypvrlihkywkesgdetffnydikkafnmiidlwrveqyhrek
sdysfqrlncsvtdtlsheglgtpvtytgmtwsgfrpsddaceygylipanmfavvalry
iseiaekvykdeelkekadslreeidnaiekhgkvykegfgevyayetdgmgnynfmdda
nvpsllsipyleykgiedevyqntrkfilsknnrfffegkaakgigsphtpdqyiwhial
smqglttnnqeeidqlikllketdagtgymhegfhvddptkftrdwfawsnslfshfiye
kvink

SCOPe Domain Coordinates for d3qt3a_:

Click to download the PDB-style file with coordinates for d3qt3a_.
(The format of our PDB-style files is described here.)

Timeline for d3qt3a_: