Lineage for d3qt2f_ (3qt2 F:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 912412Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 912413Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 912488Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 912611Protein automated matches [190501] (2 species)
    not a true protein
  7. 912612Species Human (Homo sapiens) [TaxId:9606] [187448] (8 PDB entries)
  8. 912622Domain d3qt2f_: 3qt2 F: [184616]
    automated match to d1hula_
    complexed with bgc, mpd

Details for d3qt2f_

PDB Entry: 3qt2 (more details), 2.55 Å

PDB Description: structure of a cytokine ligand-receptor complex
PDB Compounds: (F:) Interleukin-5

SCOPe Domain Sequences for d3qt2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qt2f_ a.26.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqggtv
erlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewiie

SCOPe Domain Coordinates for d3qt2f_:

Click to download the PDB-style file with coordinates for d3qt2f_.
(The format of our PDB-style files is described here.)

Timeline for d3qt2f_: