Lineage for d3qt2c_ (3qt2 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705721Protein automated matches [190501] (4 species)
    not a true protein
  7. 2705722Species Human (Homo sapiens) [TaxId:9606] [187448] (21 PDB entries)
  8. 2705757Domain d3qt2c_: 3qt2 C: [184613]
    automated match to d1hula_
    complexed with bgc, mpd

Details for d3qt2c_

PDB Entry: 3qt2 (more details), 2.55 Å

PDB Description: structure of a cytokine ligand-receptor complex
PDB Compounds: (C:) Interleukin-5

SCOPe Domain Sequences for d3qt2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qt2c_ a.26.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
teiptsalvketlallsthrtllianetlripvpvhknhqlcteeifqgigtlesqtvqg
gtverlfknlslikkyidgqkkkcgeerrrvnqfldylqeflgvmntewi

SCOPe Domain Coordinates for d3qt2c_:

Click to download the PDB-style file with coordinates for d3qt2c_.
(The format of our PDB-style files is described here.)

Timeline for d3qt2c_: