SCOPe 2.03: Domain d3qspb_: 3qsp B:

Lineage for d3qspb_ (3qsp B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.0: automated matches [191318] (1 protein)
   not a true family

6. Protein automated matches [190108] (7 species)
   not a true protein

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189664] (3 PDB entries)

8. Domain d3qspb_: 3qsp B: [184612]
   automated match to d2nvpa1
   complexed with edo

Details for d3qspb_

PDB Entry: 3qsp, 2.1 Å

PDB Description: analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of n-linked glycans, streptococcus pneumoniae sp_2144 non-productive substrate complex with alpha-1,6-mannobiose

PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3qspb_:

Sequence; same for both SEQRES and ATOM records:

>d3qspb_ a.102.1.0 (B:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mvyskeivrewldevaerakdypewvdvfercytdtldntveiledgstfvltgdipamw
lrdstaqlrpylhvakrdallrqtiaglvkrqmtlvlkdpyansfnieenwkghhetdht
dlngwiwerkyevdslcyplqlayllwketgetsqfdeifvaatkeilhlwtveqdhkns
pyrfvrdtdrkedtlvndgfgpdfavtgmtwsafrpsddccqysylipsnmfavvvlgyv
qeifaalnladsqsviadakrlqdeiqegiknyayttnskgekiyafevdglgnasimdd
pnvpsllaapylgycsvddevyqatrrtilssenpyfyqgeyasglgsshtfyryiwpia
lsiqglttrdkaekkflldqlvacdggtgvmhesfhvddptlysrewfswanmmfcelvl
dyldir

Timeline for d3qspb_:

• d3qspb_ first appeared in SCOPe 2.01
  
• d3qspb_ appears in SCOPe 2.02
  
• d3qspb_ appears in SCOPe 2.04
  
• d3qspb_ appears in the current release, SCOPe 2.08