Lineage for d3qspa_ (3qsp A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722309Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2722310Protein automated matches [190108] (23 species)
    not a true protein
  7. 2722356Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189664] (3 PDB entries)
  8. 2722359Domain d3qspa_: 3qsp A: [184611]
    automated match to d2nvpa1
    complexed with edo

Details for d3qspa_

PDB Entry: 3qsp (more details), 2.1 Å

PDB Description: analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of n-linked glycans, streptococcus pneumoniae sp_2144 non-productive substrate complex with alpha-1,6-mannobiose
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3qspa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qspa_ a.102.1.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mvyskeivrewldevaerakdypewvdvfercytdtldntveiledgstfvltgdipamw
lrdstaqlrpylhvakrdallrqtiaglvkrqmtlvlkdpyansfnieenwkghhetdht
dlngwiwerkyevdslcyplqlayllwketgetsqfdeifvaatkeilhlwtveqdhkns
pyrfvrdtdrkedtlvndgfgpdfavtgmtwsafrpsddccqysylipsnmfavvvlgyv
qeifaalnladsqsviadakrlqdeiqegiknyayttnskgekiyafevdglgnasimdd
pnvpsllaapylgycsvddevyqatrrtilssenpyfyqgeyasglgsshtfyryiwpia
lsiqglttrdkaekkflldqlvacdggtgvmhesfhvddptlysrewfswanmmfcelvl
dyldir

SCOPe Domain Coordinates for d3qspa_:

Click to download the PDB-style file with coordinates for d3qspa_.
(The format of our PDB-style files is described here.)

Timeline for d3qspa_: