Lineage for d3qs6a1 (3qs6 A:5-513)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633977Fold f.54: SNF-like [161069] (1 superfamily)
    12 transmembrane helices; duplication: consists of two structurally similar halves
  4. 2633978Superfamily f.54.1: SNF-like [161070] (1 family) (S)
  5. 2633979Family f.54.1.1: SNF-like [161071] (2 proteins)
    Pfam PF00209; Sodium:neurotransmitter symporter
  6. 2634034Protein automated matches [190994] (2 species)
    not a true protein
  7. 2634039Species Aquifex aeolicus [TaxId:63363] [188708] (7 PDB entries)
  8. 2634046Domain d3qs6a1: 3qs6 A:5-513 [184607]
    Other proteins in same PDB: d3qs6a2
    automated match to d2a65a1
    complexed with bog, na, trp; mutant

Details for d3qs6a1

PDB Entry: 3qs6 (more details), 2.8 Å

PDB Description: crystal structure of leut mutant f259v,i359q bound to sodium and l- tryptophan
PDB Compounds: (A:) Na(+):neurotransmitter symporter (Snf family)

SCOPe Domain Sequences for d3qs6a1:

Sequence, based on SEQRES records: (download)

>d3qs6a1 f.54.1.1 (A:5-513) automated matches {Aquifex aeolicus [TaxId: 63363]}
rehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiewa
mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikflv
glvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsili
rgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvw
iaavgqifftlslgvgaiityasyvrkdqdivlsgltaatlnekaevilggsisipaava
ffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaqmqpmi
afledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiff
wifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtvw
itrfyiiglflfltflvflaerrrnhesa

Sequence, based on observed residues (ATOM records): (download)

>d3qs6a1 f.54.1.1 (A:5-513) automated matches {Aquifex aeolicus [TaxId: 63363]}
rehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiewa
mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikflv
glvpeppptdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsilirg
iskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvwia
avgqifftlslgvgaiityasyvrkdqdivlsgltaatlnekaevilggsisipaavaff
gvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaqmqpmiaf
ledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiffwi
fgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtvwit
rfyiiglflfltflvflaerrrnhesa

SCOPe Domain Coordinates for d3qs6a1:

Click to download the PDB-style file with coordinates for d3qs6a1.
(The format of our PDB-style files is described here.)

Timeline for d3qs6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qs6a2