Lineage for d3qs5a1 (3qs5 A:5-513)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028745Fold f.54: SNF-like [161069] (1 superfamily)
    12 transmembrane helices; duplication: consists of two structurally similar halves
  4. 3028746Superfamily f.54.1: SNF-like [161070] (3 families) (S)
  5. 3028747Family f.54.1.1: SNF-like [161071] (2 proteins)
    Pfam PF00209; Sodium:neurotransmitter symporter
  6. 3028802Protein automated matches [190994] (2 species)
    not a true protein
  7. 3028807Species Aquifex aeolicus [TaxId:63363] [188708] (7 PDB entries)
  8. 3028812Domain d3qs5a1: 3qs5 A:5-513 [184606]
    Other proteins in same PDB: d3qs5a2
    automated match to d2a65a1
    complexed with bog, na, trp; mutant

Details for d3qs5a1

PDB Entry: 3qs5 (more details), 2.6 Å

PDB Description: crystal structure of leut mutant i359q bound to sodium and l- tryptophan
PDB Compounds: (A:) Na(+):neurotransmitter symporter (Snf family)

SCOPe Domain Sequences for d3qs5a1:

Sequence, based on SEQRES records: (download)

>d3qs5a1 f.54.1.1 (A:5-513) automated matches {Aquifex aeolicus [TaxId: 63363]}
rehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiewa
mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikflv
glvpepppnatdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsili
rgiskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvw
iaavgqifftlslgfgaiityasyvrkdqdivlsgltaatlnekaevilggsisipaava
ffgvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaqmqpmi
afledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiff
wifgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtvw
itrfyiiglflfltflvflaerrrnhesa

Sequence, based on observed residues (ATOM records): (download)

>d3qs5a1 f.54.1.1 (A:5-513) automated matches {Aquifex aeolicus [TaxId: 63363]}
rehwatrlglilamagnavglgnflrfpvqaaengggafmipyiiafllvgiplmwiewa
mgryggaqghgttpaifyllwrnrfakilgvfglwiplvvaiyyvyieswtlgfaikflv
glvpeppptdpdsilrpfkeflysyigvpkgdepilkpslfayivflitmfinvsilirg
iskgierfakiamptlfilavflvirvflletpngtaadglnflwtpdfeklkdpgvwia
avgqifftlslgfgaiityasyvrkdqdivlsgltaatlnekaevilggsisipaavaff
gvanavaiakagafnlgfitlpaifsqtaggtflgflwffllffagltssiaqmqpmiaf
ledelklsrkhavlwtaaivffsahlvmflnksldemdfwagtigvvffglteliiffwi
fgadkaweeinrggiikvpriyyyvmryitpaflavllvvwareyipkimeethwtvwit
rfyiiglflfltflvflaerrrnhesa

SCOPe Domain Coordinates for d3qs5a1:

Click to download the PDB-style file with coordinates for d3qs5a1.
(The format of our PDB-style files is described here.)

Timeline for d3qs5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qs5a2