![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) ![]() |
![]() | Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins) Family 2 zinc amidase; |
![]() | Protein automated matches [190549] (4 species) not a true protein |
![]() | Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (40 PDB entries) |
![]() | Domain d3qs0d_: 3qs0 D: [184604] automated match to d1ycka1 complexed with gol, nag, tla |
PDB Entry: 3qs0 (more details), 2.5 Å
SCOPe Domain Sequences for d3qs0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qs0d_ d.118.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra
Timeline for d3qs0d_: