![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
![]() | Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) ![]() |
![]() | Family a.102.1.0: automated matches [191318] (1 protein) not a true family |
![]() | Protein automated matches [190108] (21 species) not a true protein |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [189664] (3 PDB entries) |
![]() | Domain d3qryb_: 3qry B: [184600] automated match to d2nvpa1 complexed with dmj, edo |
PDB Entry: 3qry (more details), 1.75 Å
SCOPe Domain Sequences for d3qryb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qryb_ a.102.1.0 (B:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} mvyskeivrewldevaerakdypewvdvfercytdtldntveiledgstfvltgdipamw lrdstaqlrpylhvakrdallrqtiaglvkrqmtlvlkdpyansfnieenwkghhetdht dlngwiwerkyevdslcyplqlayllwketgetsqfdeifvaatkeilhlwtveqdhkns pyrfvrdtdrkedtlvndgfgpdfavtgmtwsafrpsddccqysylipsnmfavvvlgyv qeifaalnladsqsviadakrlqdeiqegiknyayttnskgekiyafevdglgnasimdd pnvpsllaapylgycsvddevyqatrrtilssenpyfyqgeyasglgsshtfyryiwpia lsiqglttrdkaekkflldqlvacdggtgvmhesfhvddptlysrewfswanmmfcelvl dyldir
Timeline for d3qryb_: