Class a: All alpha proteins [46456] (289 folds) |
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) automatically mapped to Pfam PF02807 |
Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins) |
Protein Creatine kinase, N-domain [48036] (7 species) |
Species Chicken (Gallus gallus), mitochondria [TaxId:9031] [48037] (1 PDB entry) |
Domain d1crkc1: 1crk C:1-98 [18460] Other proteins in same PDB: d1crka2, d1crkb2, d1crkc2, d1crkd2 complexed with po4 |
PDB Entry: 1crk (more details), 3 Å
SCOPe Domain Sequences for d1crkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1crkc1 a.83.1.1 (C:1-98) Creatine kinase, N-domain {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} tvhekrklfppsadypdlrkhnncmaecltpaiyaklrdkltpngysldqciqtgvdnpg hpfiktvgmvagdeesyevfaeifdpvikarhngydpr
Timeline for d1crkc1: