Lineage for d3qrwa_ (3qrw A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1151047Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 1152087Protein automated matches [190085] (34 species)
    not a true protein
  7. 1152290Species Streptomyces coelicolor [TaxId:1902] [189970] (5 PDB entries)
  8. 1152294Domain d3qrwa_: 3qrw A: [184597]
    automated match to d1w4zb_
    complexed with fmt, ndp; mutant

Details for d3qrwa_

PDB Entry: 3qrw (more details), 2.79 Å

PDB Description: actinorhodin polyketide ketoreductase mutant p94l bound to nadph
PDB Compounds: (A:) ketoacyl reductase

SCOPe Domain Sequences for d3qrwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qrwa_ c.2.1.2 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
dsevalvtgatsgigleiarrlgkeglrvfvcargeeglrttlkelreagveadgrtcdv
rsvpeiealvaavverygpvdvlvnnagrlgggataeladelwldvvetnltgvfrvtkq
vlkaggmlergtgrivniastggkqgvvhaapysaskhgvvgftkalglelartgitvna
vcpgfvetpmaasvrehysdiwevsteeafdritarvpigryvqpsevaemvayligpga
aavtaqalnvcgglgny

SCOPe Domain Coordinates for d3qrwa_:

Click to download the PDB-style file with coordinates for d3qrwa_.
(The format of our PDB-style files is described here.)

Timeline for d3qrwa_: