![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins) |
![]() | Protein automated matches [190243] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187016] (11 PDB entries) |
![]() | Domain d3qrfg_: 3qrf G: [184594] automated match to d2a07f1 protein/DNA complex; complexed with mg |
PDB Entry: 3qrf (more details), 2.8 Å
SCOPe Domain Sequences for d3qrfg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qrfg_ a.4.5.14 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mrppftyatlirwaileapekqrtlneiyhwftrmfaffrnhpatwknairhnlslhkcf vrvesekgavwtvdelefrkkr
Timeline for d3qrfg_: